Paralogue Annotation for RYR1 residue 2283

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2283
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2283

No paralogue variants have been mapped to residue 2283 for RYR1.



RYR1YLLENSGIG--L-GMQGSTPLDVAAASVID>N<NELALALQEQDLEKVVSYLAGCGLQSCPML2313
RYR2YLLENSSVGLASPAMRGSTPLDVAAASVMD>N<NELALALREPDLEKVVRYLAGCGLQSCQML2280
RYR3YLLENSSVGLASPSMRGSTPLDVAASSVMD>N<NELALSLEEPDLEKVVTYLAGCGLQSCPML2177
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N2283Hc.6847A>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Characterization of recessive RYR1 mutations in core myopathies. Hum Mol Genet. 2006 15(18):2791-803. 16940308
Unknown Clinical utility gene card for: Multi-minicore disease. Eur J Hum Genet. 2012 20(2). doi: 10.1038/ejhg.2011.180. 22009146