Paralogue Annotation for RYR1 residue 2311

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2311
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2311

No paralogue variants have been mapped to residue 2311 for RYR1.



RYR1IDNNELALALQEQDLEKVVSYLAGCGLQSC>P<MLVAKGYPDIGWNPCGGERYLDFLRFAVFV2341
RYR2MDNNELALALREPDLEKVVRYLAGCGLQSC>Q<MLVSKGYPDIGWNPVEGERYLDFLRFAVFC2308
RYR3MDNNELALSLEEPDLEKVVTYLAGCGLQSC>P<MLLAKGYPDVGWNPIEGERYLSFLRFAVFV2205
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P2311Lc.6932C>T Putative BenignSIFT:
Polyphen: probably damaging