Paralogue Annotation for RYR1 residue 2340

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2340
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2340

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2F2307LCatecholaminergic polymorphic ventricular tachycarHigh9 18752142, 24025405

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1CPMLVAKGYPDIGWNPCGGERYLDFLRFAV>F<VNGESVEENANVVVRLLIRKPECFGPALRG2370
RYR2CQMLVSKGYPDIGWNPVEGERYLDFLRFAV>F<CNGESVEENANVVVRLLIRRPECFGPALRG2337
RYR3CPMLLAKGYPDVGWNPIEGERYLSFLRFAV>F<VNSESVEENASVVVKLLIRRPECFGPALRG2234
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F2340Lc.7018T>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145