Paralogue Annotation for RYR1 residue 2343

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2343
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2343

No paralogue variants have been mapped to residue 2343 for RYR1.



RYR1LVAKGYPDIGWNPCGGERYLDFLRFAVFVN>G<ESVEENANVVVRLLIRKPECFGPALRGEGG2373
RYR2LVSKGYPDIGWNPVEGERYLDFLRFAVFCN>G<ESVEENANVVVRLLIRRPECFGPALRGEGG2340
RYR3LLAKGYPDVGWNPIEGERYLSFLRFAVFVN>S<ESVEENASVVVKLLIRRPECFGPALRGEGG2237
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G2343Sc.7027G>A Putative BenignSIFT: tolerated
Polyphen: benign