Paralogue Annotation for RYR1 residue 2345

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2345
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2345

No paralogue variants have been mapped to residue 2345 for RYR1.



RYR1AKGYPDIGWNPCGGERYLDFLRFAVFVNGE>S<VEENANVVVRLLIRKPECFGPALRGEGGSG2375
RYR2SKGYPDIGWNPVEGERYLDFLRFAVFCNGE>S<VEENANVVVRLLIRRPECFGPALRGEGGNG2342
RYR3AKGYPDVGWNPIEGERYLSFLRFAVFVNSE>S<VEENASVVVKLLIRRPECFGPALRGEGGNG2239
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2345Tc.7034G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Functional and genetic characterization of clinical malignant hyperthermia crises: a multi-centre study. Orphanet J Rare Dis. 2014 9(1):8. doi: 10.1186/1750-1172-9-8. 24433488
Other Disease Phenotype A novel missense mutation of RYR1 in familial idiopathic hyper CK-emia. J Neurol Sci. 2015 356(1-2):142-7. doi: 10.1016/j.jns.2015.06.035. 26119398
p.S2345Cc.7033A>T Putative BenignSIFT:
Polyphen:
p.S2345Rc.7035C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy RYR1-related myopathies: a wide spectrum of phenotypes throughout life. Eur J Neurol. 2015 22(7):1094-112. doi: 10.1111/ene.12713. 25960145