Paralogue Annotation for RYR1 residue 2381

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2381
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2381

No paralogue variants have been mapped to residue 2381 for RYR1.



RYR1NVVVRLLIRKPECFGPALRGEGGSGLLAAI>E<EAIRISEDPARDGPGIRRDRRREHFGEEPP2411
RYR2NVVVRLLIRRPECFGPALRGEGGNGLLAAM>E<EAIKIAEDPSRDGPSPNS-GSSKTLDTEEE2377
RYR3SVVVKLLIRRPECFGPALRGEGGNGLLAAM>Q<GAIKISENPALDLPSQGY-KREVSTGDDEE2274
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2381Kc.7141G>A Putative BenignSIFT:
Polyphen: possibly damaging