Paralogue Annotation for RYR1 residue 2402

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2402
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2402

No paralogue variants have been mapped to residue 2402 for RYR1.



RYR1GGSGLLAAIEEAIRISEDPARDGPGIRRDR>R<REHFGEEPPEENRVHLGHAIMSFYAALIDL2432
RYR2GGNGLLAAMEEAIKIAEDPSRDGPSPNS-G>S<SKTLDTEEEEDDTIHMGNAIMTFYSALIDL2398
RYR3GGNGLLAAMQGAIKISENPALDLPSQGY-K>R<EVSTGDDEEEEEIVHMGNAIMSFYSALIDL2295
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2402Wc.7204C>T Putative BenignSIFT: deleterious
Polyphen: benign