Paralogue Annotation for RYR1 residue 2431

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2431
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2431

No paralogue variants have been mapped to residue 2431 for RYR1.



RYR1RRREHFGEEPPEENRVHLGHAIMSFYAALI>D<LLGRCAPEMHLIQAGKGEALRIRAILRSLV2461
RYR2GSSKTLDTEEEEDDTIHMGNAIMTFYSALI>D<LLGRCAPEMHLIHAGKGEAIRIRSILRSLI2427
RYR3KREVSTGDDEEEEEIVHMGNAIMSFYSALI>D<LLGRCAPEMHLIQTGKGEAIRIRSILRSLV2324
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2431Nc.7291G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy North American malignant hyperthermia population: screening of the ryanodine receptor gene and identification of novel mutations. Anesthesiology. 2001 95(3):594-9. 11575529
Unknown Actionable exomic incidental findings in 6503 participants: challenges of variant classification. Genome Res. 2015 25(3):305-15. doi: 10.1101/gr.183483.114. 25637381
p.D2431Yc.7291G>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Mutations in RYR1 in malignant hyperthermia and central core disease. Hum Mutat. 2006 27(10):977-89. 16917943
Other Myopathy Genetic variation in RYR1 and malignant hyperthermia phenotypes. Br J Anaesth. 2009 103(4):538-48. doi: 10.1093/bja/aep204. 19648156