Paralogue Annotation for RYR1 residue 2437

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2437
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2437

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2A2403TVentricular tachycardia, polymorphicHigh9 15466642, 24025405, 24136861

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1GEEPPEENRVHLGHAIMSFYAALIDLLGRC>A<PEMHLIQAGKGEALRIRAILRSLVPLEDLV2467
RYR2DTEEEEDDTIHMGNAIMTFYSALIDLLGRC>A<PEMHLIHAGKGEAIRIRSILRSLIPLGDLV2433
RYR3GDDEEEEEIVHMGNAIMSFYSALIDLLGRC>A<PEMHLIQTGKGEAIRIRSILRSLVPTEDLV2330
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2437Vc.7310C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Malignant hyperthermia in North America: genetic screening of the three hot spots in the type I ryanodine receptor gene. Anesthesiology. 2004 101(4):824-30. 15448513