Paralogue Annotation for RYR1 residue 2468

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2468
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2468

No paralogue variants have been mapped to residue 2468 for RYR1.



RYR1PEMHLIQAGKGEALRIRAILRSLVPLEDLV>G<IISLPLQIPTLGKDGALVQPKMSASFVPDH2498
RYR2PEMHLIHAGKGEAIRIRSILRSLIPLGDLV>G<VISIAFQMPTIAKDGNVVEPDMSAGFCPDH2464
RYR3PEMHLIQTGKGEAIRIRSILRSLVPTEDLV>G<IISIPLKLPSLNKDGSVSEPDMAANFCPDH2361
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G2468Dc.7403G>A Putative BenignSIFT:
Polyphen: possibly damaging