Paralogue Annotation for RYR1 residue 2474

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2474
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2474

No paralogue variants have been mapped to residue 2474 for RYR1.



RYR1QAGKGEALRIRAILRSLVPLEDLVGIISLP>L<QIPTLGKDGALVQPKMSASFVPDHKASMVL2504
RYR2HAGKGEAIRIRSILRSLIPLGDLVGVISIA>F<QMPTIAKDGNVVEPDMSAGFCPDHKAAMVL2470
RYR3QTGKGEAIRIRSILRSLVPTEDLVGIISIP>L<KLPSLNKDGSVSEPDMAANFCPDHKAPMVL2367
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L2474Vc.7420C>G Putative BenignSIFT: tolerated
Polyphen: benign