Paralogue Annotation for RYR1 residue 2495

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2495
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2495

No paralogue variants have been mapped to residue 2495 for RYR1.



RYR1DLVGIISLPLQIPTLGKDGALVQPKMSASF>V<PDHKASMVLFLDRVYGIENQDFLLHVLDVG2525
RYR2DLVGVISIAFQMPTIAKDGNVVEPDMSAGF>C<PDHKAAMVLFLDRVYGIEVQDFLLHLLEVG2491
RYR3DLVGIISIPLKLPSLNKDGSVSEPDMAANF>C<PDHKAPMVLFLDRVYGIKDQTFLLHLLEVG2388
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2495Mc.7483G>A Putative BenignSIFT:
Polyphen: possibly damaging