Paralogue Annotation for RYR1 residue 2529

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2529
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2529

No paralogue variants have been mapped to residue 2529 for RYR1.



RYR1KASMVLFLDRVYGIENQDFLLHVLDVGFLP>D<MRAAASLDTATFSTTEMALALNRYLCLAVL2559
RYR2KAAMVLFLDRVYGIEVQDFLLHLLEVGFLP>D<LRAAASLDTAALSATDMALALNRYLCTAVL2525
RYR3KAPMVLFLDRVYGIKDQTFLLHLLEVGFLP>D<LRASASLDTVSLSTTEAALALNRYICSAVL2422
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2529Nc.7585G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Recessive RYR1 mutations in a patient with severe congenital nemaline myopathy with ophthalomoplegia identified through massively parallel sequencing. Am J Med Genet A. 2012 158A(4):772-8. doi: 10.1002/ajmg.a.35243. 22407809