Paralogue Annotation for RYR1 residue 2538

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2538
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2538

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2T2504MArrhythmogenic right ventricular dysplasia type 2High9 11159936, 16239587, 22374134, 24025405, 24978818

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1RVYGIENQDFLLHVLDVGFLPDMRAAASLD>T<ATFSTTEMALALNRYLCLAVLPLITKCAPL2568
RYR2RVYGIEVQDFLLHLLEVGFLPDLRAAASLD>T<AALSATDMALALNRYLCTAVLPLLTRCAPL2534
RYR3RVYGIKDQTFLLHLLEVGFLPDLRASASLD>T<VSLSTTEAALALNRYICSAVLPLLTRCAPL2431
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2538Mc.7613C>T Putative BenignSIFT: deleterious
Polyphen: benign