Paralogue Annotation for RYR1 residue 2559

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2559
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2559

No paralogue variants have been mapped to residue 2559 for RYR1.



RYR1DMRAAASLDTATFSTTEMALALNRYLCLAV>L<PLITKCAPLFAGTEHRAIMVDSMLHTVYRL2589
RYR2DLRAAASLDTAALSATDMALALNRYLCTAV>L<PLLTRCAPLFAGTEHHASLIDSLLHTVYRL2555
RYR3DLRASASLDTVSLSTTEAALALNRYICSAV>L<PLLTRCAPLFAGTEHCTSLIDSTLQTIYRL2452
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L2559Qc.7676T>A Putative BenignSIFT:
Polyphen: benign