Paralogue Annotation for RYR1 residue 2564

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2564
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2564

No paralogue variants have been mapped to residue 2564 for RYR1.



RYR1ASLDTATFSTTEMALALNRYLCLAVLPLIT>K<CAPLFAGTEHRAIMVDSMLHTVYRLSRGRS2594
RYR2ASLDTAALSATDMALALNRYLCTAVLPLLT>R<CAPLFAGTEHHASLIDSLLHTVYRLSKGCS2560
RYR3ASLDTVSLSTTEAALALNRYICSAVLPLLT>R<CAPLFAGTEHCTSLIDSTLQTIYRLSKGRS2457
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2564Nc.7692G>C Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Expanding genotype/phenotype of neuromuscular diseases by comprehensive target capture/NGS. Neurol Genet. 2015 1(2):e14. doi: 10.1212/NXG.0000000000000015. eColl 27066551