Paralogue Annotation for RYR1 residue 2600

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2600
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2600

No paralogue variants have been mapped to residue 2600 for RYR1.



RYR1AGTEHRAIMVDSMLHTVYRLSRGRSLTKAQ>R<DVIEDCLMSLCRYIRPSMLQHLLRRLVFDV2630
RYR2AGTEHHASLIDSLLHTVYRLSKGCSLTKAQ>R<DSIEVCLLSICGQLRPSMMQHLLRRLVFDV2596
RYR3AGTEHCTSLIDSTLQTIYRLSKGRSLTKAQ>R<DTIEECLLAICNHLRPSMLQQLLRRLVFDV2493
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2600Hc.7799G>A Putative BenignSIFT:
Polyphen: benign