Paralogue Annotation for RYR1 residue 2627

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2627
Reference Amino Acid: V - Valine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2627

No paralogue variants have been mapped to residue 2627 for RYR1.



RYR1KAQRDVIEDCLMSLCRYIRPSMLQHLLRRL>V<FDVPILNEFAKMPLKLLTNHYERCWKYYCL2657
RYR2KAQRDSIEVCLLSICGQLRPSMMQHLLRRL>V<FDVPLLNEHAKMPLKLLTNHYERCWKYYCL2623
RYR3KAQRDTIEECLLAICNHLRPSMLQQLLRRL>V<FDVPQLNEYCKMPLKLLTNHYEQCWKYYCL2520
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2627Lc.7879G>C Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Frequency and localization of mutations in the 106 exons of the RYR1 gene in 50 individuals with malignant hyperthermia. Hum Mutat. 2006 27(8):830. 16835904
p.V2627Mc.7879G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Exome sequencing reveals novel rare variants in the ryanodine receptor and calcium channel genes in malignant hyperthermia families. Anesthesiology. 2013 119(5):1054-65. doi: 10.1097/ALN.0b013e3182a8a998. 24013571
p.V2627Ac.7880T>C Putative BenignSIFT:
Polyphen: