Paralogue Annotation for RYR1 residue 2632

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2632
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2632

No paralogue variants have been mapped to residue 2632 for RYR1.



RYR1VIEDCLMSLCRYIRPSMLQHLLRRLVFDVP>I<LNEFAKMPLKLLTNHYERCWKYYCLPTGWA2662
RYR2SIEVCLLSICGQLRPSMMQHLLRRLVFDVP>L<LNEHAKMPLKLLTNHYERCWKYYCLPGGWG2628
RYR3TIEECLLAICNHLRPSMLQQLLRRLVFDVP>Q<LNEYCKMPLKLLTNHYEQCWKYYCLPSGWG2525
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2632Mc.7896C>G Putative BenignSIFT:
Polyphen: benign