Paralogue Annotation for RYR1 residue 2650

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2650
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2650

No paralogue variants have been mapped to residue 2650 for RYR1.



RYR1QHLLRRLVFDVPILNEFAKMPLKLLTNHYE>R<CWKYYCLPTGWANFGVTSEEELHLTRKLFW2680
RYR2QHLLRRLVFDVPLLNEHAKMPLKLLTNHYE>R<CWKYYCLPGGWGNFGAASEEELHLSRKLFW2646
RYR3QQLLRRLVFDVPQLNEYCKMPLKLLTNHYE>Q<CWKYYCLPSGWGSYGLAVEEELHLTEKLFW2543
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2650Hc.7949G>A Putative BenignSIFT:
Polyphen: benign