Paralogue Annotation for RYR1 residue 2653

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2653
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2653

No paralogue variants have been mapped to residue 2653 for RYR1.



RYR1LRRLVFDVPILNEFAKMPLKLLTNHYERCW>K<YYCLPTGWANFGVTSEEELHLTRKLFWGIF2683
RYR2LRRLVFDVPLLNEHAKMPLKLLTNHYERCW>K<YYCLPGGWGNFGAASEEELHLSRKLFWGIF2649
RYR3LRRLVFDVPQLNEYCKMPLKLLTNHYEQCW>K<YYCLPSGWGSYGLAVEEELHLTEKLFWGIF2546
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2653Rc.7958A>G Putative BenignSIFT:
Polyphen: benign