Paralogue Annotation for RYR1 residue 2724

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2724
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2724

No paralogue variants have been mapped to residue 2724 for RYR1.



RYR1ELYRMAMPCLCAIAGALPPDYVDASYSSKA>E<KKATVDAEGNFDPRPVETLNVIIPEKLDSF2754
RYR2ELFKLALPCLSAVAGALPPDYMESNYVSMM>E<KQSSMDSEGNFNPQPVDTSNITIPEKLEYF2720
RYR3DLFRMALPCLSAIAGALPPDYLDTRITATL>E<KQISVDADGNFDPKPINTMNFSLPEKLEYI2617
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2724Kc.8170G>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Novel variants near the central domain of RYR1 in two malignant hyperthermia-susceptible families from Taiwan. Anesth Analg. 2009 109(4):1273-7. 19762757