Paralogue Annotation for RYR1 residue 2776

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2776
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2776

No paralogue variants have been mapped to residue 2776 for RYR1.



RYR1IIPEKLDSFINKFAEYTHEKWAFDKIQNNW>S<YGENIDEELKTHPMLRPYKTFSEKDKEIYR2806
RYR2TIPEKLEYFINKYAEHSHDKWSMDKLANGW>I<YGEIYSDSSKVQPLMKPYKLLSEKEKEIYR2772
RYR3SLPEKLEYIVTKYAEHSHDKWACDKSQSGW>K<YGISLDENVKTHPLIRPFKTLTEKEKEIYR2669
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S2776Fc.8327C>T ConflictSIFT:
Polyphen:
ReportsOther Myopathy King-Denborough syndrome with and without mutations in the skeletal muscle ryanodine receptor (RYR1) gene. Neuromuscul Disord. 2011 21(6):420-7. 21514828
Other Myopathy Using exome data to identify malignant hyperthermia susceptibility mutations. Anesthesiology. 2013 119(5):1043-53. doi: 10.1097/ALN.0b013e3182a8a8e7. 24195946
Other Myopathy Next-generation Sequencing of RYR1 and CACNA1S in Malignant Hyperthermia and Exertional Heat Illness. Anesthesiology. 2015 122(5):1033-46. doi: 10.1097/ALN.0000000000000610. 25658027