Paralogue Annotation for RYR1 residue 2805

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2805
Reference Amino Acid: Y - Tyrosine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2805

No paralogue variants have been mapped to residue 2805 for RYR1.



RYR1WSYGENIDEELKTHPMLRPYKTFSEKDKEI>Y<RWPIKESLKAMIAWEWTIEKAREGEEEK--2833
RYR2WIYGEIYSDSSKVQPLMKPYKLLSEKEKEI>Y<RWPIKESLKTMLAWGWRIERTREGDSMALY2801
RYR3WKYGISLDENVKTHPLIRPFKTLTEKEKEI>Y<RWPARESLKTMLAVGWTVERTKEGEALVQQ2698
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2805Sc.8414A>C Putative BenignSIFT:
Polyphen: benign