Paralogue Annotation for RYR1 residue 2811

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2811
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2811

No paralogue variants have been mapped to residue 2811 for RYR1.



RYR1IDEELKTHPMLRPYKTFSEKDKEIYRWPIK>E<SLKAMIAWEWTIEKAREGEEEK--TEKKKT2839
RYR2YSDSSKVQPLMKPYKLLSEKEKEIYRWPIK>E<SLKTMLAWGWRIERTREGDSMALYNRTRRI2807
RYR3LDENVKTHPLIRPFKTLTEKEKEIYRWPAR>E<SLKTMLAVGWTVERTKEGEALVQQRENEKL2704
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2811Ac.8432A>C Putative Benignrs373238255SIFT: deleterious
Polyphen: benign