Paralogue Annotation for RYR1 residue 2835

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2835
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2835

No paralogue variants have been mapped to residue 2835 for RYR1.



RYR1WPIKESLKAMIAWEWTIEKAREGEEEK--T>E<KKKTRKISQSAQTYDPREGYNPQPPDLSAV2865
RYR2WPIKESLKTMLAWGWRIERTREGDSMALYN>R<TRRISQTSQV--SVDAAHGYSPRAIDMSNV2831
RYR3WPARESLKTMLAVGWTVERTKEGEALVQQR>E<NEKLRSVSQA--NQ--GNSYSPAPLDLSNV2726
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E2835Dc.8505A>T BenignSIFT:
Polyphen: benign