Paralogue Annotation for RYR1 residue 2891

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2891
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2891

No paralogue variants have been mapped to residue 2891 for RYR1.



RYR1DLSAVTLSRELQAMAEQLAENYHNTWGRKK>K<QELEAKGGGTHPLLVPYDTLTAKEKARDRE2921
RYR2DMSNVTLSRDLHAMAEMMAENYHNIWAKKK>K<MELESKGGGNHPLLVPYDTLTAKEKAKDRE2887
RYR3DLSNVVLSRELQGMVEVVAENYHNIWAKKK>K<LELESKGGGSHPLLVPYDTLTAKEKFKDRE2782
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2891Qc.8671A>C Putative BenignSIFT:
Polyphen: benign