Paralogue Annotation for RYR1 residue 2909

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2909
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2909

No paralogue variants have been mapped to residue 2909 for RYR1.



RYR1AENYHNTWGRKKKQELEAKGGGTHPLLVPY>D<TLTAKEKARDREKAQELLKFLQMNGYAVTR2939
RYR2AENYHNIWAKKKKMELESKGGGNHPLLVPY>D<TLTAKEKAKDREKAQDILKFLQINGYAVSR2905
RYR3AENYHNIWAKKKKLELESKGGGSHPLLVPY>D<TLTAKEKFKDREKAQDLFKFLQVNGIIVSR2800
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2909Nc.8725G>A Putative BenignSIFT: deleterious
Polyphen: benign