Paralogue Annotation for RYR1 residue 291

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 291
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 291

No paralogue variants have been mapped to residue 291 for RYR1.



RYR1LEPLRISWSGSHLRWGQPLRVRHVTTGQYL>A<LTEDQGLVVVDASKAHTKATSFCFRI---S318
RYR2LETLRVAWSGSHIRWGQPFRLRHVTTGKYL>S<LMEDKNLLLMDKEKADVKSTAFTFRS---S334
RYR3VEPLRISWSGSNIRWGQAFRLRHLTTGHYL>A<LTEDQGLILQDRAKSDTKSTAFSFRASKEL326
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A291Vc.872C>T Putative BenignSIFT:
Polyphen: possibly damaging