Paralogue Annotation for RYR1 residue 2938

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2938
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2938

No paralogue variants have been mapped to residue 2938 for RYR1.



RYR1YDTLTAKEKARDREKAQELLKFLQMNGYAV>T<RGLKDMELDSSSIEKRFAFGFLQQLLRWMD2968
RYR2YDTLTAKEKAKDREKAQDILKFLQINGYAV>S<RGFKDLELDTPSIEKRFAYSFLQQLIRYVD2934
RYR3YDTLTAKEKFKDREKAQDLFKFLQVNGIIV>S<RGMKDMELDASSMEKRFAYKFLKKILKYVD2829
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2938Ic.8813C>T Putative BenignSIFT: tolerated
Polyphen: benign