Paralogue Annotation for RYR1 residue 2966

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2966
Reference Amino Acid: W - Tryptophan
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2966

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR2Y2932HArrhythmogenic right ventricular dysplasia/cardiomMedium5 25041964

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR1.



RYR1AVTRGLKDMELDSSSIEKRFAFGFLQQLLR>W<MDISQEFIAHLEAVVSSGRVEKSPHEQEIK2996
RYR2AVSRGFKDLELDTPSIEKRFAYSFLQQLIR>Y<VDEAHQYILEFDGG-SRGKGEHFPYEQEIK2961
RYR3IVSRGMKDMELDASSMEKRFAYKFLKKILK>Y<VDSAQEFIAHLEAIVSSGKTEKSPRDQEIK2857
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

There are currently no reported variants at residue 2966 for RYR1.