Paralogue Annotation for RYR1 residue 2997

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 2997
Reference Amino Acid: F - Phenylalanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 2997

No paralogue variants have been mapped to residue 2997 for RYR1.



RYR1MDISQEFIAHLEAVVSSGRVEKSPHEQEIK>F<FAKILLPLINQYFTNHCLYFLSTPAKVLGS3027
RYR2VDEAHQYILEFDGG-SRGKGEHFPYEQEIK>F<FAKVVLPLIDQYFKNHRLYFLSAASRPLCS2992
RYR3VDSAQEFIAHLEAIVSSGKTEKSPRDQEIK>F<FAKVLLPLVDQYFTSHCLYFLSSPLKPLSS2888
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.F2997Lc.8991C>A Putative BenignSIFT: deleterious
Polyphen: benign