Paralogue Annotation for RYR1 residue 304

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 304
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 304

No paralogue variants have been mapped to residue 304 for RYR1.



RYR1RWGQPLRVRHVTTGQYLALTEDQGLVVVDA>S<KAHTKATSFCFRI---SKEKLDVAPKRDVE331
RYR2RWGQPFRLRHVTTGKYLSLMEDKNLLLMDK>E<KADVKSTAFTFRS---SKEKLDVGVRKEVD347
RYR3RWGQAFRLRHLTTGHYLALTEDQGLILQDR>A<KSDTKSTAFSFRASKELKEKLDSSHKRDIE339
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S304Nc.911G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging