Paralogue Annotation for RYR1 residue 3081

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3081
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3081

No paralogue variants have been mapped to residue 3081 for RYR1.



RYR1RHRVSLFGTDAPAVVNCLHILARSLDARTV>M<KSGPEIVKAGLRSFFESASEDIEKMVENLR3111
RYR2RHRISLFGNDATSIVNCLHILGQTLDARTV>M<KTGLESVKSALRAFLDNAAEDLEKTMENLK3076
RYR3RHRISLFGSDSTTMVSCLHILAQTLDTRTV>M<KSGSELVKAGLRAFFENAAEDLEKTSENLK2972
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M3081Tc.9242T>C ConflictSIFT:
Polyphen:
ReportsOther Myopathy RYR1 mutations are a common cause of congenital myopathies with central nuclei. Ann Neurol. 2010 68(5):717-26. 20839240
Other Myopathy Using exome data to identify malignant hyperthermia susceptibility mutations. Anesthesiology. 2013 119(5):1043-53. doi: 10.1097/ALN.0b013e3182a8a8e7. 24195946
Other Myopathy Evaluation of ACMG-Guideline-Based Variant Classification of Cancer Susceptibility and Non-Cancer-Associated Genes in Families Affected by Breast Cancer. Am J Hum Genet. 2016 98(5):801-17. doi: 10.1016/j.ajhg.2016.02.024. 27153395
p.M3081Vc.9241A>G Putative BenignSIFT: tolerated
Polyphen: benign
p.M3081Ic.9243G>A Putative BenignSIFT:
Polyphen: