Paralogue Annotation for RYR1 residue 3116

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3116
Reference Amino Acid: S - Serine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3116

No paralogue variants have been mapped to residue 3116 for RYR1.



RYR1EIVKAGLRSFFESASEDIEKMVENLRLGKV>S<QARTQVKGVGQNLTYTTVALLPVLTTLFQH3146
RYR2ESVKSALRAFLDNAAEDLEKTMENLKQGQF>T<HTRNQPKGVTQIINYTTVALLPMLSSLFEH3111
RYR3ELVKAGLRAFFENAAEDLEKTSENLKLGKF>T<HSRTQIKGVSQNINYTTVALLPILTSIFEH3007
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S3116Lc.9347C>T Putative BenignSIFT:
Polyphen: benign