Paralogue Annotation for RYR1 residue 32

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 32
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 32

No paralogue variants have been mapped to residue 32 for RYR1.



RYR1-AE-GEDEVQFLRTDDEVVLQCSATVLKEQ>L<KLCLAAEGFGNRLCFLEPTSNAQNVPPDLA62
RYR2GGE-GEDEIQFLRTDDEVVLQCTATIHKEQ>Q<KLCLAAEGFGNRLCFLESTSNSKNVPPDLS63
RYR3GGEGGEDEIQFLRTEDEVVLQCIATIHKEQ>R<KFCLAAEGLGNRLCFLEPTSEAKYIPPDLC64
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L32Fc.94C>T Putative BenignSIFT:
Polyphen: probably damaging