Paralogue Annotation for RYR1 residue 3202

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3202
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3202

No paralogue variants have been mapped to residue 3202 for RYR1.



RYR1IYSLGTTKNTYVEKLRPALGECLARLAAAM>P<VAFLEPQLNEYNACSVYTTKSPRERAILGL3232
RYR2LYALGTSKSIYVERQRSALGECLAAFAGAF>P<VAFLETHLDKHNIYSIYNTKSSRERAALSL3197
RYR3LYSLGTGKNIYVERQRPALGECLASLAAAI>P<VAFLEPTLNRYNPLSVFNTKTPRERSILGM3093
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P3202Lc.9605C>T Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Recessive RYR1 mutations cause unusual congenital myopathy with prominent nuclear internalization and large areas of myofibrillar disorganization. Neuropathol Appl Neurobiol. 2011 37(3):271-84. doi: 10.1111/j.1365-2990.2010.01149. 21062345