Paralogue Annotation for RYR1 residue 3212

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3212
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3212

No paralogue variants have been mapped to residue 3212 for RYR1.



RYR1YVEKLRPALGECLARLAAAMPVAFLEPQLN>E<YNACSVYTTKSPRERAILGLPNSVEEMCPD3242
RYR2YVERQRSALGECLAAFAGAFPVAFLETHLD>K<HNIYSIYNTKSSRERAALSLPTNVEDVCPN3207
RYR3YVERQRPALGECLASLAAAIPVAFLEPTLN>R<YNPLSVFNTKTPRERSILGMPDTVEDMCPD3103
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3212Kc.9634G>A Putative BenignSIFT:
Polyphen: benign
p.E3212Gc.9635A>G Putative BenignSIFT:
Polyphen: benign