Paralogue Annotation for RYR1 residue 3239

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3239
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3239

No paralogue variants have been mapped to residue 3239 for RYR1.



RYR1QLNEYNACSVYTTKSPRERAILGLPNSVEE>M<CPDIPVLERLMADIGGLAESGARYTEMPHV3269
RYR2HLDKHNIYSIYNTKSSRERAALSLPTNVED>V<CPNIPSLEKLMEEIVELAESGIRYTQMPHV3234
RYR3TLNRYNPLSVFNTKTPRERSILGMPDTVED>M<CPDIPQLEGLMKEINDLAESGARYTEMPHV3130
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M3239Kc.9716T>A Putative BenignSIFT: deleterious
Polyphen: benign