Paralogue Annotation for RYR1 residue 3243

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3243
Reference Amino Acid: I - Isoleucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3243

No paralogue variants have been mapped to residue 3243 for RYR1.



RYR1YNACSVYTTKSPRERAILGLPNSVEEMCPD>I<PVLERLMADIGGLAESGARYTEMPHVIEIT3273
RYR2HNIYSIYNTKSSRERAALSLPTNVEDVCPN>I<PSLEKLMEEIVELAESGIRYTQMPHVMEVI3238
RYR3YNPLSVFNTKTPRERSILGMPDTVEDMCPD>I<PQLEGLMKEINDLAESGARYTEMPHVIEVI3134
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I3243Vc.9727A>G Putative BenignSIFT: tolerated
Polyphen: benign