Paralogue Annotation for RYR1 residue 3266

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3266
Reference Amino Acid: M - Methionine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3266

No paralogue variants have been mapped to residue 3266 for RYR1.



RYR1VEEMCPDIPVLERLMADIGGLAESGARYTE>M<PHVIEITLPMLCSYLPRWWERGPEAPPSAL3296
RYR2VEDVCPNIPSLEKLMEEIVELAESGIRYTQ>M<PHVMEVILPMLCSYMSRWWEHGPENNPE--3259
RYR3VEDMCPDIPQLEGLMKEINDLAESGARYTE>M<PHVIEVILPMLCNYLSYWWERGPENLPP--3155
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M3266Lc.9796A>C Putative BenignSIFT:
Polyphen: benign
p.M3266Ic.9798G>A Putative BenignSIFT:
Polyphen: benign