Paralogue Annotation for RYR1 residue 3267

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3267
Reference Amino Acid: P - Proline
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3267

No paralogue variants have been mapped to residue 3267 for RYR1.



RYR1EEMCPDIPVLERLMADIGGLAESGARYTEM>P<HVIEITLPMLCSYLPRWWERGPEAPPSALP3297
RYR2EDVCPNIPSLEKLMEEIVELAESGIRYTQM>P<HVMEVILPMLCSYMSRWWEHGPENNPE---3259
RYR3EDMCPDIPQLEGLMKEINDLAESGARYTEM>P<HVIEVILPMLCNYLSYWWERGPENLPP---3155
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P3267Lc.9800C>T Putative BenignSIFT:
Polyphen: benign