Paralogue Annotation for RYR1 residue 327

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 327
Reference Amino Acid: K - Lysine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 327

No paralogue variants have been mapped to residue 327 for RYR1.



RYR1VVDASKAHTKATSFCFRI---SKEKLDVAP>K<RDVEGMGPPEIKYGESLCFVQHVASGLWLT357
RYR2LMDKEKADVKSTAFTFRS---SKEKLDVGV>R<KEVDGMGTSEIKYGDSVCYIQHVDTGLWLT373
RYR3LQDRAKSDTKSTAFSFRASKELKEKLDSSH>K<RDIEGMGVPEIKYGDSVCFVQHIASGLWVT365
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K327Ec.979A>G Putative BenignSIFT:
Polyphen: possibly damaging