Paralogue Annotation for RYR1 residue 3273

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3273
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3273

No paralogue variants have been mapped to residue 3273 for RYR1.



RYR1IPVLERLMADIGGLAESGARYTEMPHVIEI>T<LPMLCSYLPRWWERGPEAPPSALPAGAPPP3303
RYR2IPSLEKLMEEIVELAESGIRYTQMPHVMEV>I<LPMLCSYMSRWWEHGPENNPE----RAEMC3264
RYR3IPQLEGLMKEINDLAESGARYTEMPHVIEV>I<LPMLCNYLSYWWERGPENLPP----STGPC3160
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T3273Mc.9818C>T Putative BenignSIFT: tolerated
Polyphen: benign