Paralogue Annotation for RYR1 residue 3299

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3299
Reference Amino Acid: G - Glycine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3299

No paralogue variants have been mapped to residue 3299 for RYR1.



RYR1VIEITLPMLCSYLPRWWERGPEAPPSALPA>G<APPPCTAVTSDHLNSLLGNILRIIVNNLGI3329
RYR2VMEVILPMLCSYMSRWWEHGPENNPE---->R<AEMCCTALNSEHMNTLLGNILKIIYNNLGI3290
RYR3VIEVILPMLCNYLSYWWERGPENLPP---->S<TGPCCTKVTSEHLSLILGNILKIINNNLGI3186
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G3299Sc.9895G>A Putative BenignSIFT: tolerated
Polyphen: benign
p.G3299Vc.9896G>T Putative BenignSIFT: tolerated
Polyphen: benign