Paralogue Annotation for RYR1 residue 3326

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3326
Reference Amino Acid: N - Asparagine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3326

No paralogue variants have been mapped to residue 3326 for RYR1.



RYR1LPAGAPPPCTAVTSDHLNSLLGNILRIIVN>N<LGIDEASWMKRLAVFAQPIVSRARPELLQS3356
RYR2---RAEMCCTALNSEHMNTLLGNILKIIYN>N<LGIDEGAWMKRLAVFSQPIINKVKPQLLKT3317
RYR3---STGPCCTKVTSEHLSLILGNILKIINN>N<LGIDEASWMKRIAVYAQPIISKARPDLLRS3213
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.N3326Kc.9978C>A Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Recessive mutations in RYR1 are a common cause of congenital fiber type disproportion. Hum Mutat. 2010 31(7):E1544-50. 20583297
Unknown 20301436