Paralogue Annotation for RYR1 residue 3330

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3330
Reference Amino Acid: D - Aspartate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3330

No paralogue variants have been mapped to residue 3330 for RYR1.



RYR1APPPCTAVTSDHLNSLLGNILRIIVNNLGI>D<EASWMKRLAVFAQPIVSRARPELLQSHFIP3360
RYR2AEMCCTALNSEHMNTLLGNILKIIYNNLGI>D<EGAWMKRLAVFSQPIINKVKPQLLKTHFLP3321
RYR3TGPCCTKVTSEHLSLILGNILKIINNNLGI>D<EASWMKRIAVYAQPIISKARPDLLRSHFIP3217
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D3330Gc.9989A>G Other MyopathySIFT:
Polyphen:
ReportsOther Myopathy Genotype-phenotype correlations in recessive RYR1-related myopathies. Orphanet J Rare Dis. 2013 8:117. doi: 10.1186/1750-1172-8-117. 23919265