Paralogue Annotation for RYR1 residue 3349

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3349
Reference Amino Acid: A - Alanine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3349

No paralogue variants have been mapped to residue 3349 for RYR1.



RYR1ILRIIVNNLGIDEASWMKRLAVFAQPIVSR>A<RPELLQSHFIPTIGRLRKRAGKVVSEEEQL3379
RYR2ILKIIYNNLGIDEGAWMKRLAVFSQPIINK>V<KPQLLKTHFLPLMEKLKKKAATVVSEEDHL3340
RYR3ILKIINNNLGIDEASWMKRIAVYAQPIISK>A<RPDLLRSHFIPTLEKLKKKAVKTVQEEEQL3236
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A3349Gc.10046C>G Putative Benignrs199531105SIFT:
Polyphen: benign