Paralogue Annotation for RYR1 residue 3376

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3376
Reference Amino Acid: E - Glutamate
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3376

No paralogue variants have been mapped to residue 3376 for RYR1.



RYR1VSRARPELLQSHFIPTIGRLRKRAGKVVSE>E<EQLRLEAKAEAQEGELLVRDEFSVLCRDLY3406
RYR2INKVKPQLLKTHFLPLMEKLKKKAATVVSE>E<DHLKAEARGDMSEAELLILDEFTTLARDLY3367
RYR3ISKARPDLLRSHFIPTLEKLKKKAVKTVQE>E<EQLKADGKGDTQEAELLILDEFAVLCRDLY3263
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E3376Kc.10126G>A Putative BenignSIFT: deleterious
Polyphen: benign