Paralogue Annotation for RYR1 residue 3412

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 3412
Reference Amino Acid: L - Leucine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 3412

No paralogue variants have been mapped to residue 3412 for RYR1.



RYR1EAKAEAQEGELLVRDEFSVLCRDLYALYPL>L<IRYVDNNRAQWLTEPNPSAEELFRMVGEIF3442
RYR2EARGDMSEAELLILDEFTTLARDLYAFYPL>L<IRFVDYNRAKWLKEPNPEAEELFRMVAEVF3403
RYR3DGKGDTQEAELLILDEFAVLCRDLYAFYPM>L<IRYVDNNRSNWLKSPDADSDQLFRMVAEVF3299
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L3412Fc.10234C>T Putative BenignSIFT:
Polyphen: benign